PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI11G01380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 380aa    MW: 41445 Da    PI: 6.5158
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI11G01380.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS366.44.1e-112233732374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkfs 94 
                       +lLl+cAe v++++l +a+++L ++ ela+p g+++qR+aayf+eA++arl++s+ +ly+ l +ps+++ + + +++aa+++f+ +sP++kfs
  ORUFI11G01380.1  23 LTLLLQCAESVNADNLDEAHRALLEIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLpNPSPAAARLHGRVAAAFQVFNGISPFVKFS 116
                      579************************************************************777777777799999**************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrled 188
                      h+taNqaI ea+e+eer          GlQWp L++ LasRp+gpp++R+Tg+g+    s e+le+tg+rL++fA++lg+pfef + va++  +
  ORUFI11G01380.1 117 HFTANQAIQEAFEREER----------GLQWPGLFHILASRPGGPPRVRLTGLGA----SMEALEATGKRLSDFADTLGLPFEFCP-VADKAGN 195
                      ***************86..........****************************....***************************.7****** PP

             GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                      l++e+L v ++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv++veq+++h s+sFl+rf+ea++yysalfdsl+a+++++s er
  ORUFI11G01380.1 196 LDPEKLGVTRREAVAVHWLR--HSLYDVTGSDSN----TLWLIQRLAPKVVTMVEQDLSH-SGSFLARFVEAIHYYSALFDSLDASYSEDSPER 282
                      ******************99..999999999999....**********************.899****************************** PP

             GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      ++vE++ll+rei+nv+a  g +r+ + + +++Wre+l ++GF+  +l  +aa+qa lll +++sdgy++ ee+g+l lgWkd  L+++SaWr
  ORUFI11G01380.1 283 HVVEQQLLSREIRNVLAVGGPARTGDVK-FGSWREKLAQSGFRVSSLAGSAAAQAVLLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAWR 373
                      **********************999987.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.0541353IPR005202Transcription factor GRAS
PfamPF035141.4E-10923373IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MAGTATREEQ RRKQRDEEGL HLLTLLLQCA ESVNADNLDE AHRALLEIAE LATPFGTSTQ  60
RVAAYFAEAM SARLVSSCLG LYAPLPNPSP AAARLHGRVA AAFQVFNGIS PFVKFSHFTA  120
NQAIQEAFER EERGLQWPGL FHILASRPGG PPRVRLTGLG ASMEALEATG KRLSDFADTL  180
GLPFEFCPVA DKAGNLDPEK LGVTRREAVA VHWLRHSLYD VTGSDSNTLW LIQRLAPKVV  240
TMVEQDLSHS GSFLARFVEA IHYYSALFDS LDASYSEDSP ERHVVEQQLL SREIRNVLAV  300
GGPARTGDVK FGSWREKLAQ SGFRVSSLAG SAAAQAVLLL GMFPSDGYTL IEENGALKLG  360
WKDLCLLTAS AWRPIQASGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-47223734375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0734670.0AK073467.1 Oryza sativa Japonica Group cDNA clone:J033044H21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615402.10.0PREDICTED: protein SCARECROW 1
SwissprotQ2RB590.0SCR1_ORYSJ; Protein SCARECROW 1
TrEMBLA0A0E0R3K10.0A0A0E0R3K1_ORYRU; Uncharacterized protein
STRINGLOC_Os11g03110.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein